PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005617P4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 75aa    MW: 8701.28 Da    PI: 10.8644
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005617P4genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.99.7e-32959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye+s+
  MELO3C005617P4  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSN 59
                    79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.146161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-39160IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.26E-29361IPR002100Transcription factor, MADS-box
CDDcd002656.28E-37359No hitNo description
PRINTSPR004049.2E-32323IPR002100Transcription factor, MADS-box
PfamPF003194.6E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP RGKLYEFSNC  60
RYIQTSIFFY FPKK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A3e-17359258Myocyte-specific enhancer factor 2A
3mu6_B3e-17359258Myocyte-specific enhancer factor 2A
3mu6_C3e-17359258Myocyte-specific enhancer factor 2A
3mu6_D3e-17359258Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818951e-122LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132631e-122LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006440498.11e-37hypothetical protein CICLE_v10023160mg
RefseqXP_006440499.11e-37hypothetical protein CICLE_v10023160mg
SwissprotQ388382e-36AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBLA0A151UCJ02e-37A0A151UCJ0_CAJCA; MADS-box protein SOC1
TrEMBLV4T0S31e-37V4T0S3_9R
STRINGPOPTR_0001s08510.12e-35(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.11e-37AGAMOUS-like 14